SCOP genetic domain sequence for sunid 43928 (from ASTRAL)

>g1ai0.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn