SCOP genetic domain sequence for sunid 43909 (from ASTRAL)

>g1fu2.4 g.1.1.1 (H:,G:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn