SCOP genetic domain sequence for sunid 129545 (from ASTRAL)

>d2bz4b2 c.95.1.1 (B:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd